The short version of plasma peptide fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-04-03. Anything still debated is marked as such rather than presented as settled.
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide backbone consists of glycine, histidine, and lysine joined in that order. Copper is held through the imidazole nitrogen of histidine and the alpha-amino group at the N-terminus, which together produce a square-planar arrangement around the metal center. The solid appears blue to violet, a color that originates from d-d electronic transitions within the copper coordination sphere. The complex is indexed under CAS number 89030-95-5.
The sequence now called GHK was first reported in the early 1970s after isolation from human plasma, where it was noted to influence liver cell behavior in laboratory preparations. Later work described a copper-binding form and its activity in fibroblast and wound-model experiments. Review articles frequently group the substance with other copper peptides. Concentrations in blood appear to fall with age in several small surveys, although the reason for this trend is not settled. Whether such a decline carries functional consequences remains an open question.
Published work on GHK-Cu concentrates largely on cell culture systems rather than whole organisms. Frequently used endpoints include collagen synthesis, expression of matrix metalloproteinases, and migration of fibroblasts. Some reports describe antioxidant behavior, while others stress delivery of copper into cells. These mechanisms are proposed rather than demonstrated, and the relative weight of each pathway is unclear. Human trials are few and generally small, so laboratory findings should not be read as confirmed clinical results.
The peptide sequence places a histidine in the middle, and this residue dominates metal binding. Copper(II) coordinates through the imidazole nitrogen of histidine and the terminal amino group, forming a stable chelate ring system. Loss of the copper ion leaves the free tripeptide, which has different solubility and reactivity. This structural detail matters because assays that measure only the peptide backbone can miss whether copper is still bound to it.
Several names circulate for the same material, which complicates literature searches. Cosmetic ingredient lists often use copper tripeptide-1, while older biochemistry papers use glycyl-L-histidyl-lysine or its abbreviation GHK. The copper complex is sometimes written as GHK-Cu(II) to make the oxidation state explicit. Terminology is not fully standardized, so matching a compound across sources requires attention to the exact sequence, the counterion, and the stated copper content. Reviews that compare studies must account for these naming differences before drawing conclusions.
GHK-Cu is the copper(II) complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence of three amino acids. The peptide was first isolated from human plasma in 1973 during research on factors that influence tissue repair in liver. Its ability to bind copper ions became a central point of interest because the metal changes the peptide's chemistry and its behaviour in laboratory systems. Today the compound appears in cosmetic formulations, cell-culture studies, and biochemistry literature under several names.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Copper(II) peptide complex | Peptide chain coordinated to a single metal ion |
| CAS number | 89030-95-5 | Indexed for the peptide-copper complex |
| Molecular formula | C14H22CuN6O4 | Approximate formula for a one-to-one complex |
| Appearance | Blue to violet solid | Color from copper d-d transitions |
| Solubility class | Freely soluble in water | Also dispersible in some polar solvents |
GHK-Cu is a coordination complex formed between the tripeptide glycyl-L-histidyl-L-lysine and a copper(II) ion. The peptide binds copper through its histidine imidazole nitrogen, its terminal amino group, and a deprotonated amide nitrogen, creating a stable chelate ring. The resulting complex carries a distinctive blue to blue-violet color, which arises from copper d-d electronic transitions. In the solid state it is usually handled as a powder, while in solution the complex can dissociate and re-form depending on pH and competing ligands. The name copper tripeptide-1 is widely used in ingredient listings.
The tripeptide was first isolated from a human plasma filtrate in 1973 during studies of tissue repair factors. Later work detected the free peptide and its copper complex in saliva, urine, and wound fluid, suggesting a natural role in tissue remodeling. Plasma concentrations reported in early literature decline with age, a pattern often cited in discussions of skin aging. Whether these endogenous levels are directly functional or largely incidental remains an open question. The peptide sequence is conserved across mammalian species.
Material described in research and cosmetic supply chains is typically a synthetic peptide supplied as a lyophilized powder. Purity is commonly reported through chromatographic separation, often at 95 percent or higher, while copper content is confirmed by separate elemental analysis. Batch variation in color and solubility can reflect residual counter-ions, moisture, or partial oxidation of the peptide. Because the complex is not a single regulatory entity, specifications differ between suppliers and are not standardized internationally.
The peptide portion consists of three amino acids: glycine, histidine and lysine. Copper(II) coordinates through the imidazole nitrogen of histidine, the alpha-amino group of glycine and a deprotonated amide nitrogen of the backbone, producing a roughly square-planar geometry. This arrangement gives the complex its characteristic blue-to-violet colour and helps it resist dissociation in water. Reported stability constants are high, although values differ between studies because of differences in ionic strength and measurement method.
The International Nomenclature of Cosmetic Ingredients lists the substance as copper tripeptide-1, the name that appears on most topical product labels. Related designations include copper peptide and GHK-Cu, and the hyphenated form is common in research literature. In cosmetics the material is regulated as an ingredient rather than as a drug, so products may reach the market without evidence of the effects claimed for them. Whether those effects are clinically meaningful is an open question, since most supportive data come from laboratory work and small trials.
GHK-Cu is the copper complex of the tripeptide glycyl-L-histidyl-L-lysine, a short sequence found naturally in human plasma, saliva and urine. Loren Pickart reported the isolation of the free peptide in 1973 while studying factors that influenced the growth of aged liver cells in culture. The peptide was later shown to bind copper(II) with high affinity, and the metal-bound form became the focus of most subsequent research. Its concentration in circulation declines markedly with age, a pattern that is well documented, though the physiological consequences of that decline remain debated.
Symptoms of the disease only appear at an advanced stage, when more than two-thirds of the original kidney function has already been lost. This is due to the body's own compensatory mechanisms and the kidney's reserve capacity, which can compensate for the reduced kidney function for a long time and maintain the excretion of urine-requiring substances. With the loss of functioning nephrons—the functional structural unit of the kidney—the filtering capacity of the renal corpuscles (glomerular filtration rate) decreases and with it the excretory capacity for urinary substances. Acute damage to the tubules can regenerate again if the basement membrane is preserved. However, if a section of the nephron is irreversibly damaged, the entire nephron dies. The increased urea levels in the blood (uremia) lead to nausea and vomiting for various reasons. Firstly, they directly irritate chemoreceptors in the chemoreceptor trigger zone in the brain. Secondly, they increase gastrinsecretion and thus lead to an increase in gastric acid production and thus to hyperacidity of the stomach. Finally, they cause vascular inflammation (uraemic vasculitis), which leads to further damage to the digestive tract. As a result of the accumulation of phosphate in the blood (hyperphosphatemia) and the reduced formation of calcitriol in the remaining main parts, there is a drop in the calcium blood level (hypocalcemia) and increased parathyroid hormone is released from the parathyroid gland. Chronic kidney disease leads to hyperparathyroidism in 84% of cases (secondary renal hyperparathyroidism).
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
==== Enolisation ==== Enolisation of RuBP is the conversion of the keto tautomer of RuBP to an enediol(ate). Enolisation is initiated by deprotonation at C3. The enzyme base in this step has been debated, but the steric constraints observed in crystal structures have made Lys210 the most likely candidate. Specifically, the carbamate oxygen on Lys210 that is not coordinated with the Mg ion deprotonates the C3 carbon of RuBP to form a 2,3-enediolate.
Sanger retired in 1983, aged 65, to his home, "Far Leys", in Swaffham Bulbeck outside Cambridge. In 1992, the Wellcome Trust and the Medical Research Council founded the Sanger Centre (now the Sanger Institute), named after him. The institute is on the Wellcome Trust Genome Campus near Hinxton, only a few miles from Sanger's home. He agreed to having the Centre named after him when asked by John Sulston, the founding director, but warned, "It had better be good." It was opened by Sanger in person on 4 October 1993, with a staff of fewer than 50 people, and went on to take a leading role in the sequencing of the human genome. The Institute had about 900 people in 2020 and is one of the world's largest genomic research centres. Sanger said he found no evidence for a God so he became an agnostic. In an interview published in the Times newspaper in 2000 Sanger is quoted as saying: "My father was a committed Quaker and I was brought up as a Quaker, and for them truth is very important. I drifted away from those beliefs – one is obviously looking for truth, but one needs some evidence for it. Even if I wanted to believe in God I would find it very difficult. I would need to see proof." He declined the offer of a knighthood, as he did not wish to be addressed as "Sir". He is quoted as saying, "A knighthood makes you different, doesn't it, and I don't want to be different." In 1986 he accepted admission to the Order of Merit, which can have only 24 living members.
Sources: en.wikipedia.org
== Background == Marley was born in Covina, California and raised in Salem, Oregon. Growing up, Marley was a reptile enthusiast. From his earliest memories, Marley was always drawing, and most often his subject was monsters. His father was an aviarist and breeder of rare color mutations of Australian parrots and great blue turacos. Marley served as a missionary in the Atacama Desert in Chile for two years at 19 years old. After this, he studied design at Brigham Young University. During university, he took sabbaticals to work with fashion brands such as Donna Karan, Gucci, Nike, and Giorgio Armani.
=== Pharmacodynamics === Benorterone is an antiandrogen, or an antagonist of the androgen receptor (AR), the biological target of the androgen sex hormones testosterone and dihydrotestosterone. In one study, the affinity of benorterone for the AR was found to be about 5-fold greater than that of cyproterone acetate in rat prostate cytosol; the Ki values were 0.7 nM for benorterone and 3.7 nM for cyproterone acetate, which were 243% and 46% of those of testosterone (Ki = 1.7 nM), respectively. However, another study found that benorterone had only 11% of the affinity of dihydrotestosterone for the androgen receptor. Although an antiandrogen, benorterone actually is a very weak partial agonist of the AR and has been reported to possess weak androgenic activity. The same is true for cyproterone acetate and other steroidal antiandrogens. Unlike certain other steroidal antiandrogens such as cyproterone acetate, benorterone is not also a progestogen, instead being described as a selective and pure AR antagonist similarly to nonsteroidal antiandrogens such as flutamide and bicalutamide. However, although it is described as not being a progestogen, benorterone was found to produce "a highly variable decrease in plasma testosterone levels," indicating that it has weak antigonadotropic effects. The reasons for this are unclear, as other pure antiandrogens such as cyproterone (not cyproterone acetate) and flutamide do not do this and instead produce consistent increases in testosterone levels.
=== Promotion and release === Microsoft has been a major supporter for Compulsion Games in backing We Happy Few, leading to the game having its console debut on the Xbox One. Microsoft announced We Happy Few as part of their press conferences at Gamescom in August 2015, Electronic Entertainment Expo 2016. and Electronic Entertainment Expo 2018. This last presentation was accompanied by the news that Microsoft Studios had acquired Compulsion Games as part of their in-house studios. In August 2017, Compulsion Games announced that they have partnered with Gearbox Software for financial support to expand the game into a retail-length title, planned to release on 13 April 2018. Compulsion's Provost had known Gearbox's Randy Pitchford prior to their release of Contrast, and Contrast's visual style had caught Pitchford's attention, but the studio lacked a publishing arm at the time. By E3 2016, where Microsoft presented We Happy Few as part of its press event, Gearbox operated its Gearbox Publishing division led by Steve Gibson. Gibson, also interested in what We Happy Few offered, invited Compulsion to their offices to discuss financing and publishing opportunities for the game. Gearbox's funding helped Compulsion expand their team four-fold and expand the scope and narrative of the game. With Gearbox's help, Compulsion was able to develop We Happy Few for the PlayStation 4, while Gearbox will publish retail versions for all platforms; Microsoft's acquisition of the studio did not impact this publishing deal.
Sources: en.wikipedia.org
It is the copper complex of the tripeptide glycyl-L-histidyl-lysine. The metal ion is held by the histidine imidazole group and the peptide N-terminus. Most research on it concerns skin and wound models.
The tripeptide was first isolated from human plasma and has also been reported in saliva and urine. Plasma levels appear to decline with age in some small studies. Those observations rest on limited sample sizes.
It is not authorized as a systemic medicine in most countries. Cosmetic preparations list it as an ingredient rather than an active pharmaceutical substance. Legal status therefore differs by jurisdiction.
The peptide is glycyl-L-histidyl-L-lysine, a three-amino-acid sequence commonly abbreviated GHK. It binds a single copper(II) ion under typical laboratory conditions. The free peptide and the copper complex are separate chemical species with different properties.